SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101492 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101492
Domain Number 1 Region: 231-558
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-29
Family WD40-repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 138-220
Classification Level Classification E-value
Superfamily F-box domain 1.83e-18
Family F-box domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101492   Gene: ENSDARG00000079089   Transcript: ENSDART00000114378
Sequence length 627
Comment pep:known chromosome:Zv9:5:12952809:12994300:-1 gene:ENSDARG00000079089 transcript:ENSDART00000114378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTEEDELSVFRDRWKQELNKSTKAAKEKEGYFGDQNKDGSSVHQSTSFWENQSSVSQPT
PKEQPEYVSIAEGLLDGRSGPLLDRLEHERTRTRKRAPEIEAPKTDAPPKKVNASQKLLE
QFLQDLNEVNDIPFFDVELPYELALKIFNFLGRTDLGRCAQVSKSWKVLAEDELLWYRLC
LVEGFQKGANISDSPCWKSTVRDCRNTENAVKSNWKNRVGSIRHLQYELGKVLCDVSSCA
GLVIAGYTSGDVRLWDTLHWDKFYLKPTHSIRNETPAPYASHVRVNKTIAAAAYENGCVD
VWSTVTGLEPIHQYQHLQRVHVLDLSPDGPALASASGPDVRVDAPDEQGYWRSQSLVQLP
KPVDGVLVVPGKRDIPLVTAWAGESVYLLNSRPEEEQEPRVLHSVYGHPVTCVDTSPSRA
AMGIKSCGWGMNDGGNKIQVYGLESGQCELTMGNSAGDFTCVNLRDSGPHLLLCGNRDRR
VRVFDLRTGSSVLSLYAHHMGVTAVQADDWRIVSGGGEGLVIVWEMRIGAKLWEMHNRHP
VRHIRFSSSTLVTANIPDEKSPRGACITDDDLTAHRRYRGLICHYDFSMDSSSQDHILPI
CRSNYAESSGYNYNIGLSMPYDTLSGP
Download sequence
Identical sequences F1R9M6
ENSDARP00000101492 ENSDARP00000101492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]