SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102059 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102059
Domain Number 1 Region: 26-152
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.29e-19
Family Synaptotagmin-like (S variant) 0.0038
Further Details:      
 
Domain Number 2 Region: 152-284
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-16
Family Synaptotagmin-like (S variant) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102059   Gene: ENSDARG00000079926   Transcript: ENSDART00000109722
Sequence length 298
Comment pep:known chromosome:Zv9:12:36238811:36250264:-1 gene:ENSDARG00000079926 transcript:ENSDART00000109722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGSIRPDLYQLPEEPSEWALPDGSAVRLWFALRYQQDKEQLVVSLLRAANLPTQCQRNIT
LVKLQLLPSDDRRHRQAKARRKGCHPQFNDTFVFQVSNSCVDQCSLNMSLFTVDHQKKHH
LMGQILIPLICSELKEAAGKVQWRDLDNESDQPLSKNGDIQVSLNYNQSLHRLTVVVLRA
RGLQCCSEAALVPAVCAKVCLKIHTQVVRNKWTTVAKGNSPSFNEKLTFRLLPMQLDTAC
LSLQIQQPSTEKPVLLAIVVIGPFMYARGRELEHWNDMVSKPQELVRQWHPLGSADTV
Download sequence
Identical sequences ENSDARP00000102059 ENSDARP00000102059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]