SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102330 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102330
Domain Number 1 Region: 5-237
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.39e-41
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 240-317
Classification Level Classification E-value
Superfamily MIT domain 8.11e-23
Family MIT domain 0.001
Further Details:      
 
Domain Number 3 Region: 358-405
Classification Level Classification E-value
Superfamily MIT domain 0.000000017
Family MIT domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102330   Gene: ENSDARG00000075200   Transcript: ENSDART00000109230
Sequence length 429
Comment pep:known chromosome:Zv9:18:5016514:5035817:1 gene:ENSDARG00000075200 transcript:ENSDART00000109230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVQTDSREAVAVKVVSKKSLNKSSMENLLTEIEILKTVRHPHIVQLKDFQWDSENIYLIL
EWCSGGDLSRFIRSRRILPERVARRCLQQIGTTHTHTHTHKHTHMRTRKINIFITQNTCV
CVDFGFAQYMSPWDEQHALRGSPLYMAPEVCCMCVYSMCVDLLYVCVMCVLTVFLYVCYS
LFVFIVCALSVRSVVCVQLPAAAGVSRDCRDLLLRLLLRDPDRRISFEEFFLHPFVDLEH
MPSAESLPKAKALVLQAVQKDQDGDRSAALSLYCSALEHFVPAIHYETDRQRKEALRQKV
NQYVCRAEELKALVRSDNKISFEEARSARNILIGTSAALLIWSRICVQEESGAEDYDTDL
YQQSLGEMLLALAAEAQGRRRELLHSEIKSLMSRAEYLKELIKMRETQTDESLKKDAAAE
SVRSSCCLQ
Download sequence
Identical sequences ENSDARP00000102330 ENSDARP00000102330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]