SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102443 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102443
Domain Number 1 Region: 24-126,166-369,401-434
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.87e-39
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102443   Gene: ENSDARG00000079583   Transcript: ENSDART00000113445
Sequence length 443
Comment pep:known chromosome:Zv9:21:40254844:40335026:-1 gene:ENSDARG00000079583 transcript:ENSDART00000113445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEIDTRKINNSFLRDHNYATEADIISTVEFNPTGELLATGDKGGRVVVFQREQESKNQ
PHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKI
SERDKRPEGYNLKDEDGRIRDPSTITALRVPVLRPMDLMVEATPRRIFANAHTYHINSIS
VNSDYETYMSTDDLRINLWNLEITNRSFNIVDIKPANMEELTEVITAAEFHPNQCNTFVY
SSSKGSIRLCDMRTSALCDNHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYLMTRD
YLTVKVWDINMESKPLETYQVHDYLRSKLCSLYENDCIFDKFECVWNGTDSVLMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPNENIIAVAATNNLYIFQDKVN
Download sequence
Identical sequences A0A0R4IEA6
NP_001025293.2.45394 ENSDARP00000102443 7955.ENSDARP00000033554 ENSDARP00000102443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]