SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102600 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102600
Domain Number 1 Region: 78-162
Classification Level Classification E-value
Superfamily HMG-box 2.09e-31
Family HMG-box 0.0000154
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily HMG-box 4.19e-26
Family HMG-box 0.00000898
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102600   Gene: ENSDARG00000079772   Transcript: ENSDART00000111964
Sequence length 205
Comment pep:known chromosome:Zv9:10:37242189:37246980:-1 gene:ENSDARG00000079772 transcript:ENSDART00000111964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFE
DMAKLDKARYEREMKNYIPPKGEKKKRFKDPNAPKRPPSAFFIFCSEFRPKVKEETPGLS
IGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRSKGKVGGGAAKAPSKPDK
ANDEDEDDDEEEDEDDDDEEEEDDE
Download sequence
Identical sequences Q6NX86
ENSDARP00000102600 7955.ENSDARP00000102600 NP_955849.2.45394 XP_021328034.1.45394 ENSDARP00000102600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]