SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102605 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102605
Domain Number 1 Region: 31-350
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.04e-32
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.016
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000102605
Domain Number - Region: 792-861
Classification Level Classification E-value
Superfamily MIT domain 0.00353
Family MIT domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102605   Gene: ENSDARG00000077948   Transcript: ENSDART00000110794
Sequence length 1497
Comment pep:known chromosome:Zv9:13:22457428:22512555:1 gene:ENSDARG00000077948 transcript:ENSDART00000110794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWKRNYFASGSSGLQGIFTPRTMTSIAPSKGLINEPGQNSCFLNSALQVLWHLDIFRRS
FRQLTTHKCMEDSCIFCALKSIFAQFQFSSEKVLPSDALRCALAKTFQDEQRFQLGIMDD
AAECFENILMRIHFHISDETKEDICTAKHCIPHQKFAMTLFEQCVCSNCGASSDPLPFIQ
MVHYISTTSLCNQAVRMLECREKPTPDMFGELLRNASTVGDLRNCPGNCGEKLRIRRVLM
NSPEIITIGLVWDSDHSDLAEDVIHSLGTVLRLGDLFYRVTEDKAKQAELYLVGVVCYYG
KHYSTFFFQTKIRKWIYFDDAHVKEIGPKWKDVVSRCIKGHYQPLLLLYADPRGTPVSAQ
DLASRLDLHHYTKAYYDSEDSGREPSISSDTRTDSSTDSYSYKHSHSHHESMASHFSSDS
QGTVICNPDNDSASHSSLETTGPLTDSDTVQRHTLRKDGVLDRKAGVLDRKRSASRPRKF
EARGDSRNRVSKTDEVLSAGYHSEGETLKEQQVPRSLPKPSSSRLRDFKETMSNIIHNRP
LSASSSGSVCPPDSTIKVRDWEADSTSSESKSSSSGGRYRPPWKPRREALNIDSIFSRER
RKQAGYSPLGALLSEDTGPQVGLMSTKQITFQDIPGPLRRGSEQPPRLIQRMESGYESSE
RNSNSPVSLDMPVSEATTNGMHSLQEGAMIKPPPDVNPSWKTVTKSKSSSALLQDVKASV
KGSSHTSLAGEGRSELDELQEEVARRAREQELQRRKEKEKEAAMGFNPRPSKFMDLDELQ
NQGKGEGFERCVLEAESLLDQSLRLEQAGEVAAALSVVNEAMSKLRHTLHESSANAQGRM
QKCMRRARGLQQRMQQKQQEEEKEQKQPLSEQSVPVQILLTNVKEEDEKAISEDALRPPS
PLHIKPQSTSKPISETPGPPVPSYHTDTCSQKDNTGDHPSSLDVTENDRGPRDLVINTNS
LVQTASKRSPATVPVIAANGCEASLQSSVSLNTPAYFSARLTPSTTDHSEEGLQNPHRPQ
SLHGLSQAPHACQKSLPVPSRNWSCRSLERPDSRPTTLDSSMYSPVDLSSPSSPCPPFLS
SPVLEQRPAGPMPVERWAENVNRYYNSQKCARSGRDSPCEELSELDSLYQASLKAPSIPR
ATRGTSPQLANRSGPAVSRKHSTGSSATLGRSKTPTAEIERSAYRTPTYSTKPLQKPVSA
AAYNEPLGEDESYSAENLRRIARSLSGTVVGGRTDVPPSRSFDPHVSRMSKHVNVQLPTH
RSSTSLHVLPLPSHNPPMFPHEPPPQHLHSSHRPHPVPTSSHLHQQTLRPPHGQTGDCQK
TNKFLAVLDRGEAFSRENYHNVALSYGTLPRAPRRSVSSGPPVYQMRPGSLPRNHPDAAY
ATLSRPHRTTAPSRTMDGFYRQPHQHPSLTAPIPHHSSRHHPHTEPPTQPLRLDVPPERD
WRAARDTHVFPRTDPRGGTSRGHPVYICGLCKQNPAEPTRSYCQACRAHMSHYRMTS
Download sequence
Identical sequences A0A140LGR1
NP_001314804.1.45394 XP_021336285.1.45394 XP_021336286.1.45394 ENSDARP00000102605 ENSDARP00000102605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]