SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102730 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102730
Domain Number 1 Region: 223-333
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000283
Family F-box domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000102730
Domain Number - Region: 132-201
Classification Level Classification E-value
Superfamily SMAD MH1 domain 0.0536
Family SMAD MH1 domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102730   Gene: ENSDARG00000075172   Transcript: ENSDART00000113643
Sequence length 356
Comment pep:known chromosome:Zv9:23:35520328:35534694:-1 gene:ENSDARG00000075172 transcript:ENSDART00000113643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLGQDWRSPGWSWIKTEDGWKRFDYFSHKLGDNINELGLEELDNDNKENVYVGDVCEV
AAKKRKKDFFNNNTKSQFLFQERWIYVQKESTRERHGYCTLGEAFNRLDFSSAIQDVRRF
NYVVKLLQLIAKSQLTSLSGAAQKNYFNVLEKIVRKVLEDHQNPRLIKALLHDLSSTLCI
LIREVGKSVLVGNINIWVCRLETILKWQQQLNNLQIPKQVSNGMTLSDLPLHMQTNILYQ
FTDAYDIINLGQATPTLQMLSEDRHLWKKLCQFHFAEKQFCRHLILSEKGHVDWKLMFFT
LQKYYPQKEQYGDTLQFCRHCSILFWNDSGHPCTANDPDSCLTPVSPQHFIDLFKF
Download sequence
Identical sequences Q6TH11
7955.ENSDARP00000018696 7955.ENSDARP00000102730 7955.ENSDARP00000103267 ENSDARP00000102730 NP_991287.1.45394 ENSDARP00000102730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]