SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102893 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102893
Domain Number 1 Region: 537-613
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000747
Family Canonical RBD 0.014
Further Details:      
 
Domain Number 2 Region: 890-962
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000692
Family Canonical RBD 0.02
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000102893
Domain Number - Region: 302-326
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number - Region: 6-73
Classification Level Classification E-value
Superfamily PWI domain 0.0017
Family PWI domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102893   Gene: ENSDARG00000018889   Transcript: ENSDART00000114086
Sequence length 1009
Comment pep:known chromosome:Zv9:6:4244127:4274844:1 gene:ENSDARG00000018889 transcript:ENSDART00000114086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMIIENLEALKTWLSKTLEPICDADPSALAKYVVALVKKDKSEKELKALCIDQLDVFLQK
ETQTFVDKLFEAVNAKSYLPQPEQPTPASRPETHQRTEKDEAKREEKPPSRDEDREKKFS
RRINHSPPSSSRYSRDSRRVDDRKKDDRSRKREYDRNPPRRDSYRERYNRRRERSRSYSR
SRSRSWSKDRTRDRDRERDRDRDRSRSRSRTRSRSRSRSRERDSGKPKYEHSRPERPEGA
TTDGYTAAPLPPVNSSAHFPVPTLSSTITVIAPTHHGNNTTESWSEFPQDHTPFGRGGPP
RKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVNLPSILPFQPPPLPGVDGPPPPGLPPP
HALLTPPVNLRPPVPPPGTMPPSLPPVAGPPPPLPALQPSGMDGPPNSITSSVPTIVTSG
IRPPMTQPPPPLFTSDPFEPDVYNPEAPSMTSRPMYRHRVNAQRPNLIGLTMAEMDLPPR
EKMSNSNNARIVLESDSRKRGAGLHDLAIPPKKPWFDKPNFSKPNHHGFHRKVPFPLANT
KLAIGQIPPELNNISKLNQHFSKFGTIVNLQVAYNNDPEGALIQFATPEEARRAIQSTEA
VLNNRFIRVHWHREDTVEHMHPKPHPSVQPAQEPAVTALKQSVKDRLGPLPTPHPEPTPA
PSGPPQNTLKASVKERLGFSKPPGLGTKVLSTSTGLTKTVYNPAALKAGQKGAPFSASVS
AEDALKRKQEAMKLQQDVRKKKQEILEKHIQTQKLLISRLEKNKSMKAEDKAQIMQTLTS
LTNSITKLQEEIKGLSSANALRTTVKSKAQAQKELLDTELDLYKKMQAGEDTAELKIKYT
QLQLEAAKRGLLTPGRGRGAHSRGRGALRSRGRGIRGRGRGAPTHAVVDHRPRALEISGF
SEADRVDLLPHFAQYGEIEDCQMEDSSLSAIITYKTRAEAERAAIHGVRLNNQELRLAWH
KPTASLNTTDPDEAEAEDEEFPEDSLVDDSLLQDDDEEEEDNESRSWRR
Download sequence
Identical sequences ENSDARP00000102893 ENSDARP00000102893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]