SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103234 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103234
Domain Number 1 Region: 295-390
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000266
Family WD40-repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103234   Gene: ENSDARG00000074590   Transcript: ENSDART00000112665
Sequence length 707
Comment pep:known chromosome:Zv9:17:24159122:24236178:-1 gene:ENSDARG00000074590 transcript:ENSDART00000112665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFCLAELHLWSFRNSLQVPDRDIGTYQLYEKGEPASPTDQHYYNEKQQFADSRGYPWFL
SNRRPEKLRDALKELEELLQSCPVMSVRWRSKQCCQMLLRSGVLVTLILGGAQVERVVID
RTLVGRLPADTISDAVIGDRFLLFSLMERSQVCQVYLNRKNQSSPDLARHMEKLTAAEIK
VSVADLPGGGRRVERHLGLNRTQDVAVCWWPLCNEEVRPWSPIPSAADRANLVLLACSDT
PGLTVLSSIRTDGDPIDCRFSLTQPYHILTVELHQDTKHSTSESLEEIQHPDIQTCVYEL
TRGRLQRLSSISLTLTSKPITCSRDPLERWVVLGLQDCSVVLFDPQTGLSQWATCSMMPA
VLAWHPSGSLLVVGGGQGELQCFDMGFSPLPLRLVSEEPVPGSVGSSLQLSQHFNTSEGL
EGIQWAYCPISQGNESLEVHDLLLLRFHGGPLAALRLKLGVFNGAQLGPCDLILHRLLCE
EVDAALGILGNMDWAIMGAECYRSLISITDHLLRKPLDQQTEGQLEAALGVFYAPCRPLS
NTVILEYRDPISRYARRFFHHLLRHQRFEKAFLLAVDIGARDLFMDLHYVAADKGEVVLA
AVAKKKANEIDAEAQTSAPDECQSAYGGQSGVKLPATISERHVHDLKHWSTASRAVETSS
SKAQDDLSNTQTSHSSWPWKHTEINLVDQNTQGPEEGKLKVIHFGLV
Download sequence
Identical sequences E7F9Q9
ENSDARP00000103234 XP_005158592.1.45394 ENSDARP00000103234 ENSDARP00000129643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]