SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103646 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103646
Domain Number 1 Region: 5-78
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.79e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000103646
Domain Number - Region: 401-466
Classification Level Classification E-value
Superfamily F-box domain 0.000327
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103646   Gene: ENSDARG00000079957   Transcript: ENSDART00000113692
Sequence length 587
Comment pep:known chromosome:Zv9:13:2094953:2116488:-1 gene:ENSDARG00000079957 transcript:ENSDART00000113692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADVKKVLQLKRQLKECNDGHTLLKILNKLEVLDITLEILAETGIGKVVNSFRKHDEA
GKVAKVLVNRWKALVPKGSISLTEGNPEDCQTQNEKLNKEENESRRKENSRISDSSNSRK
KPKLDNSKAEKKSSPIVDIKCKTKSSKYKMISNGEDSDNEEPKKDSSLSQGSRTHGSDHN
KEKKHESKKTESVSGVTKKQKKLEKSLKVTRDKNGDACKKDKRKARDKPTALEIEGKLED
ICENPSMSFEAYLSYDLEPPKRKKSFNVSKNSKRIKTTHKESSNVSLVKMSKSVTEEPIT
AVHQKQVPEQSVMDLLNVPLPMSLPECEDLSQYQYFSEKKDDRRATEVCEDEEAAPMFIG
QRLKNKMQVYSGSKMAFLPSMMTLYQQCIRALQNNIDSLYEIGGVPFEILEPVLERCTAE
QLLRIEECNPVYIGVTDHLWEKHCQKEFRNACLEEYESWREMYLRLFEERERKLQQLTKS
IVSAHSGKPKGRQVKMAFIHSAAKPPRNVRIQQEIHGTAGPVTAPHPTDRAGSVKPNENR
VRSGFIEPSKPCSTSNSSQSQDPRKIKRVAPMMAKSLKAFRKQFSRR
Download sequence
Identical sequences ENSDARP00000103646 ENSDARP00000103646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]