SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104171 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104171
Domain Number 1 Region: 32-333
Classification Level Classification E-value
Superfamily WD40 repeat-like 5e-45
Family WD40-repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104171   Gene: ENSDARG00000021082   Transcript: ENSDART00000108587
Sequence length 1250
Comment pep:known chromosome:Zv9:10:5097635:5139190:-1 gene:ENSDARG00000021082 transcript:ENSDART00000108587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKEINRTAIQAWSPAQQHPIYLAAGTSAQQLDATFSTNASLEIFELDLADSALAMKSC
GSFSSPHRYHKLVWGPHGIENQGLPSGVLIAGGENGNIILYDASKIIAGDSEVIILQSEK
HTGAVRALDVNSFQSNLVASGGNESEIYIWDLNNFSSPMTPGPKTQPQEDISCVAWNKQV
QHILASASPSGKASVWDLRKNDLIIKVSDHSNRMHCSGLAWNPEVATQLVLASEDDRMPV
IQMWDLRFATSPLKVLENHTRGILAIAWSVADPELLLSCGKDNRILCWNPNTAEVLYELP
TSTQWCFDIQWCPRNPAVLSAAAFDGHISIYSIMGGSNDNANNLQADQLSSSFGNMDPFG
TGKTLPPLQLPQQTSPQSTITPLKKPPKWIRRPVGASFAFGGKLVTLDNIKPTAQQPQQT
AAHVVHISQVVTETDFIHRSNQLQTTLNAGNFLEYCQNKIETVQNEFERTVWSFLKVNFE
EDARLKYLELLGYEKEELALKIASALEGNCKPKEADMDKEEVLAEEEADSDLDDIPVNEE
EPVVEETSNTEVPPAPASDAINLKVSQDIDGLITQALLTGDYEAAVNLCLHDNRMADGII
LAIAGGPELLAKTQRKYFSKTESKISKLISAVVMKDWLDILETCDLQNWKEALAAVMTYA
KPEEFSALCGLLGSRLESSEDVELQAQACLCYICAGTVEQLVSFWTKTQDSCSPLSLQEL
VEKVVVLQRAVEKAQGAVPADMGALLAEKMNQYASLLASQGSLQTAISYLPTNTEQVSVQ
QLRERLSRALGQHQHPQQPAAAVTGIQKMHQTRPAAVPMQTYSQPQPPAQPAAPAVPPQY
YQQGRSATTVTSWSNQTPTALPSVPRQLVPSSDPQGDSTPPAFGLQSPAMASVPASTPFM
YSQQYQNYPPVQQFTPSAGTPGIYQPLPYASSAGSPLPPPPSSSSAAVYPPQFMLSASSQ
ASAPPQSFCPPPAVSSGGCFQHGGPGSPTSYLPPPGARAPGTQHEPALIPASQRTDGFYQ
ETAWGLEGPQNGWNDPPALSRAAKKKKVPQHFTPPAPITAPIMAPLGDPQAPAGMQTLQP
QQQVPDQSAGPATFTPIQQQPLGPRNPSMPQGNMEGAPGAPIGDVIKPLQAIPTEKITKK
PIPEEHMVLKTTFEGLIQKCLTAASDPQTKRKLDDAHKRLELLYDKLREQTLSPAIIGGL
HNMAHSIECRSYADGLNIHTHIVSNSNFSETSAFMPVLKVVLTQANKLGV
Download sequence
Identical sequences F1R5G5
ENSDARP00000104171 NP_955824.2.45394 ENSDARP00000104171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]