SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104238 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104238
Domain Number 1 Region: 296-421,499-643
Classification Level Classification E-value
Superfamily RNI-like 1.16e-40
Family Cyclin A/CDK2-associated p19, Skp2 0.048
Further Details:      
 
Domain Number 2 Region: 625-745
Classification Level Classification E-value
Superfamily RNI-like 6.2e-18
Family 28-residue LRR 0.016
Further Details:      
 
Domain Number 3 Region: 220-276
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000667
Family F-box domain 0.0023
Further Details:      
 
Domain Number 4 Region: 12-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000104238
Domain Number - Region: 414-530
Classification Level Classification E-value
Superfamily RNI-like 0.00581
Family 28-residue LRR 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104238   Gene: ENSDARG00000076191   Transcript: ENSDART00000111425
Sequence length 767
Comment pep:known chromosome:Zv9:25:19255159:19268362:-1 gene:ENSDARG00000076191 transcript:ENSDART00000111425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLQDSDAIFRDYIIKHSLPQIYKALLSGLCVSCPEDPLHFMEEKILSILQDQDFEIVW
HTFIDKDKQISSLAGGIVNYIFGYPEDSLNLSHLLEKAYTCYHTNLTKMCFTGWKSYIWQ
KKMKAARLLERMEEAEMYHTQRRIKLAFIKWTAWVQFQKQRWKDAERKLQKVQESVHCRK
IITAWRHVVQDAKRTKEYFKKLERDMKESQNSGIPQGDGQDNLSLLPNRLFLKIFQSLGV
RDLLKCAQVCQSWKAITQISSLWTEIDFSPESSWITDQMVERILRLHRVYVISVNLCGCN
MVQRLSFRRISQCRNLQELDLSECPTVNDENMKMILEGCQSLLSLNLACTHIANATIKVL
ASRCCVMLRSLNLAYCIHFSDKGLQYLTTGTGCRRLRHLNLSGCSQITVDGFTSVAETCN
SLQQIVLNDLPTLTDICVQVLVSRCRMLTVISLLESLNLSDVAFKAVAEVIDLTKILIEG
NDVITDSSVKALCRSCLKLSELHLSCCPRVTDACFKTLGNLTKLCNLNISGCFKVTDMGL
HYITEGPSAGQLRELDLSYCLKITDLSLRRISQKCISLTNLALCFCENLTDNGFECLDKC
SSLISLDISGCKIHDKGLSALGANPSLRKLSAAECVFITDIGIKMFCRLCQRLELLDVCQ
CVRLSDRAIKALSFFCRTIATVRIAGCPKMTDAAVKYLTRAGHFLRELDVSGCSLLTDHT
VCFLQCSCLHLRSINMLYCRNISRQAALKLQHRVQHWKHSNDDGPTF
Download sequence
Identical sequences ENSDARP00000104238 XP_009296244.1.45394 ENSDARP00000104238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]