SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104388 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104388
Domain Number 1 Region: 1195-1447
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.94e-23
Family WD40-repeat 0.0031
Further Details:      
 
Domain Number 2 Region: 987-1279
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.1e-21
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 
Domain Number 3 Region: 1367-1655
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.57e-16
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 4 Region: 384-630
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000101
Family Extended AAA-ATPase domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104388   Gene: ENSDARG00000077162   Transcript: ENSDART00000115355
Sequence length 1735
Comment pep:known chromosome:Zv9:7:61530628:61645747:1 gene:ENSDARG00000077162 transcript:ENSDART00000115355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPSGAGSRQPCPRESALRRAAISGNVLALPPFHVPTGRSVRVFICANPDDTEAERNALK
EHVYPKLRDFCRENYGIEFQVVDLYWGIDPEEWDSPELQRLRMKLLEECLKTSAGPCFVG
LIGEKYGSIRVPGEVESAEFEMILDAAVEAGLDTRILEEWYCRDENSVPPAYYLKPKAEM
LKNYQNSMESNTVAKSKNDKAWRAVSEEIKRIFRTSVLQLQEKGTMKSGQAKKFLCSALE
DELDFALGKQTPAFLKKCVCYIRKISNFDRFAKLPEMARYMDIVVSDDRVMRNQEAYERL
LKVRDEFIPVVVAASNLRVYSSVTHCDMKLGYSQEVESHYVEGLCKQFYEDMVDIIQATV
QQNFDTETDPLYDEIIQHLSLCKTFSSFYVYKSEALDIVQEYLYPSKGGRITPQVVYGGP
CTGKTLLLAEVAKQAYSWIQKEMGPETDPVVIVRFIGSTDFSTDLRTLLQSICEQIAINY
RCLIHFLPNKIQEMRELLVNLLGESSFHRPLVIILDALEQLSDADEARKLWWLPVHLPRT
VRIVVSTLPNKHGILQKLRCLIHDEEAYVELMQRDRKACSQTLKQQLLGVKRKVTSGQQI
YVNEAMAKCTLPMFVNLIYREVVHWRSHKDVDDKSLCSTVHESIEQLFYSVENKLGSRFV
FRALGYITMARAGLTELELEDILSLDNSVLGDIMVSSNLKSPLRISYDFIARLKEELEGY
LVERQVHNVTLMVWANRHLHLIAQKLYLSNEEDVHQMHSLLAEYFLGAWAGGRKKIFHCD
NNHFASLNISQHRNPHNQQSLHGHDKASADKHSYDRQTPEQPWVFQCNLLEPDIFFVNHR
KMTELTYHLTRSGRTDDLMYGVIMNFSWLYTMIKIGQFDKALSDIDLAYSYTQEKELKFL
ATTLRSIKLKVTKNPASLSAELQQRLLPVVTSLPKLRHLLLECDKDGPKYCSIVPLHSSM
DVTYSPERLPLSSSYMQIVETLPTLAPNIVIVALEDGSVSTWDVESRQLLRQIDTARSVV
LGIRLTTDEKYLVVATTKNTLLIYDNHKSCLLSEVEVKGSKHCGITGGVAFINGFTLSSH
HALAWLEASKDVSVIDLLYGWPLYQFHCWYEVTCVQCSPDGMYAFCGQYLNTTTIFHLGS
GDKLATMTSEFSGGFVKSILILDTINQMVMIDNEGSLSVWSTKDITNPKLMEDYDCRGDD
SEVVGIELSEDQRSILICKARSIEVLDTKIWKMAEKFKAKRTEKFVAAVLSKNSQSIIAS
MENTSSIFVWRRDSGQCMASLIEISGAIVKLIKSTHHNLLLSVASSGVLSVWDIDIITAM
SNIDKTGKPIQILQLSGREDFVYTMDGSEVIHKWNYSTGFIEMVFKHEGLVENCVLTTSG
DLMVTSDDKSSQYIWHTTTGENIFRINGQKISQLLITHNDQFVVSLCEQNASRVWRLATG
HKVCNILVTLQHALITTANTFLVGANKNKLLAVSLWSGSVSKKFICDDGITIVNFKLIPD
SPDFVVFITSTETVFIWSVADESVCRRVQLPNNFLKNLEDFQISPNGKLGIVSKGDENIN
VLDLHSGKLRLVHAAGIIWRQKLSRDGRYLVYICFRNCDEDDDAGVVSSLIVMRLADGKS
IGTCSLYKTPTYLCLSQRALNIIVGFEDGSIGTYTVVDRVDAALKIKIATSNSRQIVNNA
SQKVRPKCSNNAFKTIADCVWRESTEVFSRDSPINVSDGGEPETTTPTKKTELLQ
Download sequence
Identical sequences XP_009301828.1.45394 ENSDARP00000104388 ENSDARP00000104388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]