SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104605 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104605
Domain Number 1 Region: 5-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000242
Family THAP domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104605   Gene: ENSDARG00000091514   Transcript: ENSDART00000122104
Sequence length 204
Comment pep:known chromosome:Zv9:7:53606783:53608113:-1 gene:ENSDARG00000091514 transcript:ENSDART00000122104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRCVLGCGSPETLFTFPKIPWLRSRWLDFLHFEEGAISESSRLCSKHFTQDSFKNWTR
HKMGFVKFLSLTENAVPSVYTVGASHTLKPLTRDVACQCDPPNVKSVSVRTEKQKQKVRS
KGVQVKPCWLQPVGTSFSDANSAPSCFTSTPIKRPRIEVSTFSENSKCTSKDLSDFCEPN
VKEEDSEKSVQTASVKEWKSETYT
Download sequence
Identical sequences E7EYJ9
ENSDARP00000104605 ENSDARP00000104605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]