SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104660 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104660
Domain Number 1 Region: 1358-1473
Classification Level Classification E-value
Superfamily Bromodomain 1.31e-33
Family Bromodomain 0.00031
Further Details:      
 
Domain Number 2 Region: 1190-1253
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.52e-18
Family PHD domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104660   Gene: ENSDARG00000061394   Transcript: ENSDART00000128582
Sequence length 1802
Comment pep:known chromosome:Zv9:18:39901596:39983970:1 gene:ENSDARG00000061394 transcript:ENSDART00000128582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLLGRKPYPLVKPLSEPPGPGEEVYTIEHTKEAFRNKEEYEARLRRYGERIWTCKSTG
SSQLTHKEAWEEEQEVTELLQEEYPVWFEKPVLEIVHHNTVPLDKLVDQVWVEILTKYAV
GEKCDLMVGNDKTLSVEVVKIHPLENPPEENAEKKMEGACDSPSSDKENASQENLKKEPQ
SKEEESRRESLSDRARRSPRKLPTTMKEEKKKWVMPKFLPHKYDVKLVNEDKVISDVPAD
NLFRTERPPNKEIMRYFIRHYALRLGSGESAPWVVEDELVKKFSLPSKFSDFLLDPHKFL
AENPSTKRKSLSSPEGKPRKRLKNVETGTGGEGAKGDKKKNKDSQNIPLSPTIWSHMQVK
KVNGSPLKMKNSGTSKKSDEENVLGTPKSSKKQGDKKSSDPKRRRKSGLNKTPNSQRLSK
KEDKSLGGAKKPRMKQMTLLDLAKSPAAAGSPKKQRRSSTTGSAKLGKPFPPMALHLLRF
YKENKGKEDKKTTLSSLLSKAAKALSPEDRSRLPEELKELVQKRWELLEQKRRWALMSEE
EKQSVLKQKRQEVKQKLREKAKERREKEMQVRREMSRRYEDQELEGKNLPAFRLFDMPEG
LPNTIFGDVAMVVEFLHCYSGLLMPDDQYPITSIALLEALAGEKAGFLYLNRVLVVLLQT
LLQDELAEGYSELDMPLSEIPLTMHSVSELVRLCLRPSDAHEEESARGSDDWQSGADFDD
MVSSEFLEKLETAEVFELDPQEKVSLLLALCHRILMTYSVEDHVEAVHQKSAEMWKERVA
TLKEANDRKRAEKQKRKEQMETKTDGDVLIKAEKKKESTVKKETPKVLPKEEPEPEDMIS
TVKSRRLMSIQAKKEKEEQERLNKVRMEKEAEEERIRRQKAATEKAFQDAVTKAKLVLRR
TPLGTDRNHNRYWLFSDVVPGLYIEKGWVHESIDYSFTLPPEEEPVLTEEEEEEEEVKKE
EETEDGEKEDEGSIISASNDISQQGAPSHESSIETTVPKQGQNLWFVCDTPKDFDELLES
LHPQGVRESELKIRLQINYQEILHSIHLTKKGNPGLKTCDGHQELLKFLRSDIIEVASRL
QKGGLGYLEDTSEFEEFEERVKTLEKLPEFGECVIALQESVIKKFLQGFMAPKQKKKKKT
GGEESTTAEEVDDQKKLAEEARVATAVEKWKTAVREAQTFSRMHVLLGMLDACIKWDMSA
ENARCKVCRRKGEDDKLILCDECNKAFHLFCLRPALYRIPAGEWLCPACQPTIARRSSRG
RNYKEDSEEEEDSEEEDEEESEEEDSEEEHRNTGHSLRSRKKVKTSSKSKMQKKPAKPAS
RSASKTDTNPSKTSPKSSAKPKSRAAPSSPVDIDELVRQSSKPPSRKKDVELQKCEEILQ
KIMKFRHSWPFREPVSAEEAEDYQDVITSPMDLTTMQGKFKSSEYHSASDFIEDMKLIFS
NAEEYNQPSSNVLTCMSRTEEAFVELLQKSLPGVSYLRRRTRKRAATPSDNSDDDDEEED
ERSKKQKNGKQGKKASSKRKVDNSRRKNTKRNKDDSESEEDEDEDDEEEDDERSRKQRNG
KQSKKASSRRKEDNSRRKNTKRNKDDSESEEEEDDDEEDEEEEEDDEGSKKQKNGKQDKK
NSSRKKGNSRQRNTKRNKDESEDDEDDEEEEERSKKQKNGKRSKKASSRRKEDNSRRKNT
KRNKDDSESEEDDDEEEEDEKMKKQKNRKQTTNRRKQDNSRQKKTKQNKDDSESEEDDDE
DEPVRKSKRTNRKDYHEQDSDSEQDSRRTGLRRTSRGVTDNKEASSDEDSGGQRHSKRLK
RS
Download sequence
Identical sequences ENSDARP00000104660 ENSDARP00000104660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]