SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105060 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105060
Domain Number 1 Region: 802-824
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000419
Family CCCH zinc finger 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000105060
Domain Number - Region: 696-722
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000119
Family CCCH zinc finger 0.0052
Further Details:      
 
Domain Number - Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000235
Family CCCH zinc finger 0.005
Further Details:      
 
Domain Number - Region: 750-772
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0706
Family CCCH zinc finger 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105060   Gene: ENSDARG00000090751   Transcript: ENSDART00000129803
Sequence length 929
Comment pep:known chromosome:Zv9:6:32415085:32531703:-1 gene:ENSDARG00000090751 transcript:ENSDART00000129803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEREALKREIEELQNLINDYKSTHGDVPSSAGQWGHPRRGLRSGQGQGRGHAAHYTQSY
SSLPHMAHSSGSWRKTYSLNNKTNRASGSHVFHSAVSHPSLHISTSGATATGSNDGLIGS
NSVSFKKQQPKQTKEKPVPSSHGVQCDTSKEKKSEESTKTTMLLSATEKVHHGCSSTNET
TDSTSSSGSERKIKPTLKSSAVNNPSIPSTVKAAAQLQVKPHLPPSSSSNRTVVIPSAKK
DSTTASSASNLQSQATVSPAKPQVKLDSTQTHAASPCHKRSQFTWVKSQETVNINSTPKP
LTSGSSPGMIFTRRASSSSKRVSRKPNNSPGAPKTSKYTWVSSSCSLSTAGKANPSVKLP
RKPLSPKSLKAPVRTFQGGMEGIKKEKKYTTVTVTPLKKSRAGAVTTSHASHTSRYRWKA
AGQNANASTSSSASRTTHKSTVYRWTANNNGQKGEKGSTLSPNIPATAALSVGAFKLRSR
TKIIRRSPSNPCLERRHSPNVQTLKSRYSLWRRTHTQVKSPTSIKRAQPKVLVSFGRHKL
RRLSLTSTSLGTSRSGPSSSSVRSPASHRVIKTRYKIDTRRAHAIHHNPALSYRVKRVHS
ARALLQNRMRTTSERQWRGRSMRWIGGELYRVSANKLSRTQTTCTPTSRPGEWYNPYVSS
SGHQGRTSATQYVASRAVQRSLAIIRHAKQKKQKAKQYCMYYNRFGKCNHGNTCPYIHDP
DKVAVCTRFLRGTCKKTDGTCPFSHKVAKEKMPVCSYFLKGICNNSSCPYSHVYVSRKAE
VCEDFVRGYCPQGDKCKKKHTLVCPDFSSTGVCPRGSKCKLHHRQSKKRTGSNASYGAAK
KACTRDVLRSSDAAQTQSSESTLADEGSSCSRPEKLPSFISLSSSPDGSENPDTPKIPPA
TGPQAKGKTLHIKPRFLSTTQTDPSPKEG
Download sequence
Identical sequences E7FH07
XP_689680.3.45394 ENSDARP00000105060 ENSDARP00000105060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]