SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105279 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105279
Domain Number 1 Region: 35-104
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105279   Gene: ENSDARG00000086832   Transcript: ENSDART00000131065
Sequence length 105
Comment pep:known chromosome:Zv9:17:47058221:47059445:1 gene:ENSDARG00000086832 transcript:ENSDART00000131065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNDKTKLFESLMLCSMFSVFLSSPAFVLLIGVDASSQASTHESTLYFQLIGCIIGRQGTK
INEIRQMSGAQIKIANAMEGSSDHQITITGTPANISLAQYLINAR
Download sequence
Identical sequences ENSDARP00000105279 ENSDARP00000105279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]