SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105563 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105563
Domain Number 1 Region: 23-106
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.79e-19
Family HLH, helix-loop-helix DNA-binding domain 0.00000922
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105563   Gene: ENSDARG00000024844   Transcript: ENSDART00000129816
Sequence length 165
Comment pep:known chromosome:Zv9:20:28859286:28868428:-1 gene:ENSDARG00000024844 transcript:ENSDART00000129816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVDSDEDSPRFHGVADKRAHHNALERKRRDHIKDSFHSLRDSVPALQGEKQSI
KQASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKVKGTTQLQANY
SSSDSSLYTNPKGSAVSAFDGGSDSSSESEPEEQRTRKKHRPEDS
Download sequence
Identical sequences F1QN19
XP_005160676.1.45394 ENSDARP00000044461 7955.ENSDARP00000044461 ENSDARP00000105563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]