SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106094 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106094
Domain Number 1 Region: 4-308
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.76e-71
Family WD40-repeat 0.00015
Further Details:      
 
Domain Number 2 Region: 415-484
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-24
Family U-box 0.0021
Further Details:      
 
Domain Number 3 Region: 344-412
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000157
Family SAM (sterile alpha motif) domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106094   Gene: ENSDARG00000090418   Transcript: ENSDART00000128024
Sequence length 487
Comment pep:known chromosome:Zv9:6:11917680:11945246:1 gene:ENSDARG00000090418 transcript:ENSDART00000128024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSLICTLQSHRDDVNCVAFSGDLLATCSADKSICVYSSRDFSELPFSPLSGHGYGVHCC
CFSACGQYLASCSTDATTMVWSMDTGEIEAVLEHPGRSPVRVCAFSPDSSHLVSGGSDGS
IALWDFTSRTLRRTGVVNDTSIVACSFTPCGQMFITGSTYGDLRLWDLNMNHLHAEKNAH
DLGVSCAQFAPKMMKGTDGCVQFRLASCGQDSLLKIWIVSLLPSAGIKMQLAHTLTGQSA
PVLSCAYSPDGQMLVSGSVDKTVTVYQADEGVLLYTLHQHDRYVTACAFSPTAPLIATGS
MDKSVNIWRMEEGSSAQGELFADEKAAFSNTEGRKACGHSRLMVSEWSEEEVLAWLREEG
LEAVTDAFKSNNIDGEELLSLSKETLSSDLHIESLGLRSKVMKKIEELKMVPVYNGTPDE
FLCPITREIMKDPVIAADGYSYEREAIEAWISTKNRTSPMTNLPLQTTLLTPNRTLKMAI
FRWSTSQ
Download sequence
Identical sequences E7F9P4
ENSDARP00000106094 ENSDARP00000106094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]