SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106099 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106099
Domain Number 1 Region: 32-110
Classification Level Classification E-value
Superfamily F-box domain 5.63e-18
Family F-box domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106099   Gene: ENSDARG00000086184   Transcript: ENSDART00000129052
Sequence length 157
Comment pep:novel chromosome:Zv9:1:52117857:52123828:-1 gene:ENSDARG00000086184 transcript:ENSDART00000129052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHHQKFNWENNSCSFCEKDIETVEVKKRENLLQRDFSEALPAEMSVRIFGELDVRSLCRA
SVTCKHWNDIIEGSDHLWRSHCLTGLAVCRREVNGDRLDGCSWKVTLVRNYRKGCVKRRW
LKGRYSNIRSADELPANSMCPLDVETWGEILEAELER
Download sequence
Identical sequences ENSDARP00000106099 ENSDARP00000129519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]