SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106181 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106181
Domain Number 1 Region: 18-317
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.97e-39
Family WD40-repeat 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000106181
Domain Number - Region: 418-484
Classification Level Classification E-value
Superfamily UBC-like 0.000238
Family UBC-related 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106181   Gene: ENSDARG00000088817   Transcript: ENSDART00000122009
Sequence length 965
Comment pep:known chromosome:Zv9:18:4510844:4609878:1 gene:ENSDARG00000088817 transcript:ENSDART00000122009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARWSSENVVVEFRDAQANAMSVDCLGQHAVLSGRRFLYVVNLETPSEAPRKISRQSKW
DVGTVQWNPHKSDAHIFAASSNQRVDLYTWRDGSGKSHTSLQGHTRVISDLDWSWFEPEF
LVTSSVDTYIYIWDTSDTRRPTVTLSAVAGASQVKWNRRNHYCLASSHDGDVRIWDKRKS
NTAVEYVAAHLSKINGLDWHPDNEYILATSSQDNSVRKFWDYRQPRKYLDILSCQVPVWK
ARYTPFSNGLVTVMVPQLRRENSLLLWSTLELNSPVHAFVGHDDVVYEFQWRPQKEGSKD
CQLVTLSRDQTLRIWRVDPQLQKLCCANEIVDELTTETEKTLRSQDSEPPLSPGFTADNS
LDQFDGPQSGLSSSAKNDIPQTLQQEFSLVNLQIRNVNVEMDAVNRSCFVSADCGANRVR
LVVKFPAQYPNNAAPSFQFVPPTNISSSMKIKIQKILTDTSLQKVKRNQNCLEPCVRQLV
SCLESDGVMEDGSNPYVLTNPVTPALPAFPRVTNTYGSYQDANIPFPRTSGARFCGTGSL
VYFTRPMTMHRATPPTEPTPRSLSALSAYHSGVMTPMKMRTESQTTLRLYSGSPTRTDKD
QVSISSFYYKERKSRRWKGKREGGDYSNRPIKLAGKVIIQEISCLLSVHKALGETYVLNV
NDIQDTCQKNGAAALAVARRDLAKVWALASASTNLNLSPDPDPDAGTPWAKHPFGRHLLE
TLLEHYSQLSDVQSLAMLCSVFRGHGSPQEYFTLYGHQQPRPAVFTPHHSRYPSFTSSSV
TSGSCSSTSDSANTPWNTGGRESEHPPSWGESTPDDYRYANQTYTDPREREKEQHDMNKR
LLDPSNSWQFDDFKKCYGEILHRWGMKDKRAEVLKFVSCPPEPHKGIEFGVYCCHCRSQA
RGTQCAVCKRFTFQCSICHVAVRGSSNFCLSCGHGGHTSHMMDWFRSQDVCPTGCGCHCL
QQSTF
Download sequence
Identical sequences ENSDARP00000106181 ENSDARP00000106181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]