SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107567 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107567
Domain Number 1 Region: 19-64
Classification Level Classification E-value
Superfamily MIT domain 0.0000000405
Family MIT domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107567   Gene: ENSDARG00000061211   Transcript: ENSDART00000126008
Sequence length 600
Comment pep:known chromosome:Zv9:15:33056836:33074267:-1 gene:ENSDARG00000061211 transcript:ENSDART00000126008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQAKQDRFDHARLQVIKDGYEKAFECINTGLNEDEAGHKEEALKLYQQGRQHLLRAISV
PSQGVECVGPSWESARQMQHKMQETLSNITTRLAILETTPAPNEVSNGTAAAQKLYPEVP
KVMPQRPTPPQTINGRVAGASGGQTSPTVQPNILCEQPPAYTPQAADGHLTISYGTDSGE
LSVVGDEFYSQTSNSTPAGSSLGEDGEELFFLPQGVHTPEGHVSAPSYPGYLRIVKFTSE
HSERIPNRPPAFLQVCDWLYPLMSSDSPVLLCNTGVYMFPDMMSPTPGSYVGVVLSSELP
QKERELFQNVLSQLTDLRVQVSCPCVLSHPTSETQGSAEASEQVWCSNSSQASDGATDTI
NLGQKVSLGPPAAEAAPSAAEEEKVLPEWSEKVAHGILTGASWLSWGLVKGAEYTGKAIH
KGASKLREHITPEDKPAQVSPTVTKSLHVAKQATGGAVKVSQFLVDGLCTVAGHVGRELA
PHVKKHGGKLIPESMKKDKDGRSNIDGAMVVAASGVQGFATMWTGLEVAAKNIAKSVATE
TVTTVKHKYGPDAGQATDHAVNSAINVGVTAFNIDNLGIKAMVKKTGKETAHALLSDYKV
Download sequence
Identical sequences ENSDARP00000107567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]