SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107621 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107621
Domain Number 1 Region: 57-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2e-34
Family MAM domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107621   Gene: ENSDARG00000091177   Transcript: ENSDART00000121962
Sequence length 181
Comment pep:known chromosome:Zv9:2:47419289:47422014:1 gene:ENSDARG00000091177 transcript:ENSDART00000121962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGDKAQLCTSLEDYVSACEMAEVFLPQWRNHTLCFANPTAPPTNKPTPTPSSASCPWS
CNFDQDECGWEQLIQDSFDWTRWSGSTPSNFTGPNGDHTTGSGFYMYIEGDSVVHGDSAR
IMSPDCHTSGQQCLSFWFHMYGPAHFMSLNLYKFENNRATKIWSRENNHGNRWIQGQVEI
K
Download sequence
Identical sequences ENSDARP00000107621 ENSDARP00000107621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]