SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108252 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108252
Domain Number 1 Region: 157-296
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-33
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 2 Region: 22-82
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.28e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108252   Gene: ENSDARG00000087214   Transcript: ENSDART00000124430
Sequence length 317
Comment pep:known chromosome:Zv9:2:57118915:57130311:1 gene:ENSDARG00000087214 transcript:ENSDART00000124430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSTLNNEELKSHVYKKTLQALIYPISCTTPHNFEVWTATTPTYCYECEGLLWGIARQG
MRCSECGVKCHDKCQDLLNADCLQRAAEKSSKHGAEDRTQNIIMVLKDRMKIRERNKPEI
FELIQEVFDEPKASHGTQMKQIKQSVLDGTSKWSAKISITVCCAQGLQAKDKTGSSDPYV
TVQVGKTKKRTKTIYGNLNPIWDESFHFECHNSSDRIKVRVWDEDDDIKSRVKQRFKRES
DDFLGQTIIEVRTLSGEMDVWYNLDKRTDKSAVSGAIRMHISVEIKGEETVAPYHVQYTC
LHEHIFHYTTEKQNGGV
Download sequence
Identical sequences ENSDARP00000108252 ENSDARP00000108252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]