SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108367 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108367
Domain Number 1 Region: 567-774
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-46
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 70-147
Classification Level Classification E-value
Superfamily F-box domain 2.35e-18
Family F-box domain 0.00054
Further Details:      
 
Domain Number 3 Region: 806-904
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000048
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108367   Gene: ENSDARG00000091471   Transcript: ENSDART00000129416
Sequence length 907
Comment pep:novel chromosome:Zv9:17:33595513:33613466:-1 gene:ENSDARG00000091471 transcript:ENSDART00000129416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDGAETRFSAWTPVTNKACNQQLFQERTTLVLHWFDLWTDRQRKEFICQLLRRCSKTQLK
FTNDCLAQSVPISRMDFTAVLPRLLSLYIMSFLSPRDICAAAQVCWHWKFLAEQDCLWSP
KCIRLGWFLPYSPSDYEYGAWKRHYVACAASLDILTPREAADVYGTLNESLTAPQEQEDR
WREHKIRQTIRENLAEHKKAALKTRRAWLNAICPLFCVSLPKLDRQINSFYHVRLWKNAA
LFHAILLSVTETQLKSDHMSQNYSYTFGKPFLSLKHSSLFNRPVMSSYYPLPHFLLVSSK
VPGYELLLAAVQVSVLVLPYDSQGMTLEVLFSLAERVIQGRMLQSVGILVPGSTDDIMLT
DELRITEKTVLKPCVREFWEKLCGWVVPASEGGSLNIFAPLAASVAGMGLLRKLSTLTGL
NVKAPTGICTGSYQHIVSEWCGSGEFPPLLYLHEPVLLTWCRQAEWIEEACKDLRKQLEP
QLHFMCQEIRGRILGQFLWDRIKMPVFSFKSEVMECLVHGLVALMNEAPDDPIDFLGHFL
LKSSDNSNGLKNIDPLFLTENVLLSDADRRSAVFGELLNSERTYVRQLQAVATVYYSPLR
AALDSNRAIISSVNLITLFCPLLDILETNNAFLKELAERWQEWSPLQCVGDVWVKFCTRL
RVYTNFFNNYPASLKTIDKCREMLPVFRNFLKRYDRTIATRMLSLQELLLTPSARVEEYV
ALLQALTLHTPPEHPDYTQLTSALDTLMTYRGFIHKLKKSLDRDLRMVEVQNTIQSCPNL
LEGSRYLISTQDVALLNCLNGDIAASLRMYEHVSDVGLFLFNDALVLTERSVSSMPFCVA
VNTTHTFLASVALHCLNLTEITDTKYVQNAFQLQSPKRQWICATDREEEKIRLLSALRSA
INAAITR
Download sequence
Identical sequences ENSDARP00000108367 ENSDARP00000108367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]