SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108593 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000108593
Domain Number - Region: 75-159
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0981
Family PLC-like (P variant) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108593   Gene: ENSDARG00000011727   Transcript: ENSDART00000127279
Sequence length 252
Comment pep:known chromosome:Zv9:3:39684324:39690874:-1 gene:ENSDARG00000011727 transcript:ENSDART00000127279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLASAILTLVVCRTESVHSSQGAVDNEEPLNDRYLSTARIVCCDLNAFLSGNGAKMTSNN
PAVFLLMVNGQIESADFPEYDDLYCKYCFVYGHDWAPTSGLEEGISQITSKGRLSQSLVW
NFPLDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPFTPGKHTKTIPMFVPES
TSRLQKFTSWLMGRRPEFTDPKVVAQGEGREDLLTSRHPGSATHGQNYHSISSRGHQLTD
DGNQQERKAGEE
Download sequence
Identical sequences ENSDARP00000108593 ENSDARP00000108593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]