SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108848 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108848
Domain Number 1 Region: 142-277
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.56e-42
Family Synaptotagmin-like (S variant) 0.00000312
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-29
Family Synaptotagmin-like (S variant) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108848   Gene: ENSDARG00000088293   Transcript: ENSDART00000131041
Sequence length 290
Comment pep:known chromosome:Zv9:5:64330646:64392361:1 gene:ENSDARG00000088293 transcript:ENSDART00000131041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQGLKPMDHNGLSDPYVKLHLLPGASKANKLRTKTLRNTLNPVWSETLTYYGITDEDMVR
KTLRISVCDEDKFRHNEFIGETRIPLKKLKPNQTKNFSNCLEKQLPLKSSSGMSTSFKGD
GCGFKGVDTQIDKTDDKSLEERGRIMISLKYSSQKSGLVVGIIRCAHLAAMDANGFSDPY
VKTYLKPDENKKSKHKTAVKKKTLNPEFNEEFFYEIKYADLSKKTLEVTVWDYDIGKSND
FIGGVSLGINASGERLKHWFDCLKNKDKKIERWHTLTNELPGSGGVVPTA
Download sequence
Identical sequences ENSDARP00000108848 ENSDARP00000108848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]