SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109239 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109239
Domain Number 1 Region: 14-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000411
Family PHD domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109239
Domain Number - Region: 94-140
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 0.00654
Family XRCC4, C-terminal oligomerization domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109239   Gene: ENSDARG00000087105   Transcript: ENSDART00000129223
Sequence length 206
Comment pep:known chromosome:Zv9:4:60116387:60125559:-1 gene:ENSDARG00000087105 transcript:ENSDART00000129223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKKKCVCATQEPLQHDEHCAVCKQEGDLQPCHTCTRAYHPDCLHPPLKTATRGMWMCPK
CHKKVLNKENLSWPQNFIQSYVTHKTVREEERRKLMRRNTELKLECEHLSEEDQRLCCSL
NKRVEQKERLLGQQRETQASIERLKTLIRLIQRDQMIQVTMTATTTTGASLLSLPWIKAA
GGSTTAPLAGPSAVLHKSMLQPQENN
Download sequence
Identical sequences ENSDARP00000109239 ENSDARP00000109239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]