SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109369 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109369
Domain Number 1 Region: 577-890
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.63e-58
Family WD40-repeat 0.00043
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109369
Domain Number - Region: 334-367
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 0.0314
Family Obg GTP-binding protein N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109369   Gene: ENSDARG00000059685   Transcript: ENSDART00000121497
Sequence length 894
Comment pep:known scaffold:Zv9:Zv9_scaffold3544:55620:83817:-1 gene:ENSDARG00000059685 transcript:ENSDART00000121497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEEIINIKEAEIIKLILDFLNSRKLHISMLALEKESGIINGLYSDDMLFLRQLVLDGQ
WEEVLQFIQPLEGLDKFDRKRFRYIILKQKFLEALCVNNAISASDDPENLELTMQDAVKC
LHSLEEFCPSKEDYSKLCLLLTLPRLTNHAEFKDWNPSTARVHCFEEACTMVAEFIPADR
KLSEAGFKASGDRLFQLLIKGILYECCVEFCQSKATGEEISEEEVLLAVDVLCGNGCEEL
DLSLLSWLQNLSSTVFACAFEQKTLNIHVDRLVKPARTGHADLLTPLLTKLSPCPASPLR
RPHSADTYMSRSLNPALDGLSHGLVGREKKNTEGDGKATAMSQSFANFGYPSGGNGSKNG
STVCTDSPDSVKKSLDSLISCQNPLAPEHRLRQSTALVEQTRYVLHSLLAKMEESQLQLT
NEQLQEFQRQRLRVQQHLEQKQQQRQLYHQMLLEGGVHPPDQPTDTAQHNLTQKFLNRSI
QKLEELNVGMEDLGEDVQALAQQCNGTSASESSKQTPETGPGRIKTAVISSTPHKGGVRG
IPSLDESPVLVNQRFPNILTLVFQDEKPKSPFIAVQTLEDTQAVRAVAFHPSGMLYAIGS
NSKTLRVCTYPQSLKTSPQAPVKQPDICFKRIKHHKGSIYCVAWSPCGQLLATGSNDKYV
KVLPFNADTCNIAGPDLEFSMHDGTIRDLAFMEGPESGGAILISAGAGDCNIYTTDCQRG
QGLHALSGHTGHILSLYTWGGWMIASGSQDKTVRFWDLRVPSCVKVVGTTLHGTGSAVAS
VAIDPSGRLMATGLEDCRCMLYDIRGGRSVQVYRPHSSDVRSVRFSPGAHYLLTGSYDSR
VMISDLQGDLTKNLPVTVVAEHADKVIQCRWHTRDLSFLSSSADKTVTLWAHQT
Download sequence
Identical sequences ENSDARP00000109369 ENSDARP00000109369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]