SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109398 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109398
Domain Number 1 Region: 356-481
Classification Level Classification E-value
Superfamily AXH domain 2.35e-36
Family AXH domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109398   Gene: ENSDARG00000088261   Transcript: ENSDART00000129275
Sequence length 546
Comment pep:known chromosome:Zv9:23:674388:677406:-1 gene:ENSDARG00000088261 transcript:ENSDART00000129275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSPDRSKECLPPKKRESRQGSTDQPAPEDDFKPPAPFRSRRPHQPTEGPREGGDLLPP
VPLPLPWPVSYTPSIHPHTYLPLQLGERRGSWREALCGRGVDGGLEQSVPQHSRWLSSDI
PHINMQPLLSVPTFKSVYSGDSREMWSCGLSRPDYSSSLFSPHVFPQPAVYPPDSLPDSR
LRYQSRRHNGIDGQDCKSGFSRRVPSCNDYGNDSVSRLDAPHANGRRRQENTSRQTPEKR
LPPQVSTSAHSSPWDRDPRGTPKASMPPSPDTKAGKAITSQDHFGGSASPAGAQIYYTLG
SLCPSAQQNPQVFPQPRSPLSCSARSSQNQHNSHGVETDWSSPAGPCRPPLAVLMGPDPP
PSAVLPHFAKGSLIELAGGHLKRVEELKTEDFLRSADTLPEFHLSSCTILLISPGPTYGF
NHLQVLLTDRNTQELLTVLSEYPFFVRDRGWSSCSPQRSAQLYGLQCRQLSTGDVCLALT
PTPTHKPNLAPSESRGPPGGSREPPSGTELQNTHRPRKRRWSAPELEPGAQTHTHSPLPQ
HSHTHH
Download sequence
Identical sequences ENSDARP00000109398 ENSDARP00000109398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]