SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109528 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109528
Domain Number 1 Region: 306-602
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.12e-65
Family WD40-repeat 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109528
Domain Number - Region: 103-159
Classification Level Classification E-value
Superfamily CorA soluble domain-like 0.0432
Family CorA soluble domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109528   Gene: ENSDARG00000057430   Transcript: ENSDART00000122085
Sequence length 605
Comment pep:known chromosome:Zv9:15:44800381:44841878:1 gene:ENSDARG00000057430 transcript:ENSDART00000122085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMAGRRVECLWKRHVVEQLKQRDRVQRQAFEEIIHQYNRLLEKSDLQVVFSERLQTEKYE
QQNRHDLSSKIENCSNCNNFSVLIFLQCFHNRLVLFLQLAQSVIELNNQIQQKDKEIQSN
EAKMQEYLQQISQLEGECRELRNCLADLERANQTLRDEYDALQITFSALEEKLRKTTEDN
QELVTRWMAEKAQEANKLNAENEKDSRRRQAKLQKELADAAKEPLPIDPDDDIEVLTEDA
GKATGETSPSRQLSRTPSKRLSQPPPPAGLLDSISNMFGRRRSVNSFSSSPENAEVPSAC
ADVRVPSTALHIFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWEVVSGRCEPKGALTGS
NAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSARFLLDNARIVS
GSYDRTLKLWDLRSKVCSMKTVFAGSSCNDIVCTEQCVMSGHFDKKVRFWDISYQNYHIQ
KQLNKLCRVTSLDLNHDRTELLTCSRDDLVKIIDLRTNAVRQTFNAQGFKCGSDFTRVTF
SPDGSFVAAGSADGVLYLWNVLTGKLEKTLDKGHSSAINSVSWSLSGAFVASVEKGSKAV
LWSDM
Download sequence
Identical sequences ENSDARP00000109528 ENSDARP00000109528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]