SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109694 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109694
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000686
Further Details:      
 
Domain Number 2 Region: 93-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000092
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000832
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109694   Gene: ENSDARG00000087058   Transcript: ENSDART00000123339
Sequence length 359
Comment pep:known chromosome:Zv9:5:1303133:1321687:-1 gene:ENSDARG00000087058 transcript:ENSDART00000123339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPDRVAQVMGQPERCQHAVHLINE
LVQTAQERDGFGGPLGPRGRGRGRGDWNIGTPGGLQEVTYTIPADKCGLVIGKAGGETIK
NINQQSGAHVELQRNPPPNTDPNVRIFSIRGSPQQMEMARQLIDNPLRDAGLLDYKAQFN
SLSFVIPYFGHASTNQNQLPDTKDVKLPDCYCHNNLLIDAFIYKLKHRPIQGLRPATPHQ
NPQGLKRHNGSQSGQMDYSKAWEQYYKKLGQQNQGQSSGPDYSKAWEEYYKKQSKSCRPA
ASAQAAGPGSQQSSPPDYSAAWVEYYRQQGAYYGQGQTQAPGLPGSQPTVYTNTGPQPP
Download sequence
Identical sequences ENSDARP00000109694 ENSDARP00000109694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]