SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109853 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109853
Domain Number 1 Region: 576-648
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00091
Further Details:      
 
Domain Number 2 Region: 725-828
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 956-1032
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000321
Further Details:      
 
Domain Number 4 Region: 645-721
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000328
Further Details:      
 
Domain Number 5 Region: 142-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.04e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000234
Further Details:      
 
Domain Number 6 Region: 342-428
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.35e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000204
Further Details:      
 
Domain Number 7 Region: 1036-1108
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000947
Further Details:      
 
Domain Number 8 Region: 435-504
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000646
Further Details:      
 
Domain Number 9 Region: 497-574
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 10 Region: 1107-1186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000272
Further Details:      
 
Domain Number 11 Region: 865-955
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 12 Region: 287-361
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 13 Region: 215-289
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000833
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109853
Domain Number - Region: 100-145
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109853   Gene: ENSDARG00000061864   Transcript: ENSDART00000128279
Sequence length 1259
Comment pep:known chromosome:Zv9:12:23763471:23800679:1 gene:ENSDARG00000061864 transcript:ENSDART00000128279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFAEHRSGLKDVQIMGSAPEDEAYIPTYLEAFPPLPEKGSPGEKSGEPAG
AWSKIRPIKASVITQVFHVPLEERRYKDNSQFGEGEEAKVCLDIMQKTGAHIELSLAKDQ
GLSIMVTGKLDSVMKARKEIVARLQTQASATVLIPKEHHRFVIGKNGEKLQELELKTATK
IAIPRSDDPNANIRITGTKEGIEKARHEIQLISAEQDKRAVERLCFEKAFHPFIAGAYNR
LVQELSQETGARISIPPPSIPKDEIVITGEKEAVAMAIARIRATYEEKKRKTTTISVEVK
KSQHKYIVGPKGNTLQEILENTGVSVEMPPLDSASETIILRGEPDKLGPALTQVYAKAKS
VIVAEVIAPAWLHRFIIGKKGQNISRITQQLPKVHIEFTDGEERICLEGPTEEVEQAQIQ
IQEIIKDLMVRMDYTEINIDQRFHRHLIGKNGANINRIKEQYKVSVRIPQDSERCGLVRI
EGDPQGVQLARKELMDMAQRMENERTKDLIIEQKFHRTIIGQKGEKIKEVRDKFPEVIII
FPDQQQKSDIVQLRGPKNEVEKCAKFLQKLIAELVESSFSISVPIHKQFHKNIIGKGGAN
IKKIREETNTKIDLPTENSNSEVIVITGKKSNCEAARERILAIEKELASMKEVEVSIPAK
LHNSLIGSKGSLVRSIMEDCGGVHIHFPAEGSGLDRVTIRGPAEEVERARKQLLQLAEEK
QVNNFSVELQAKPEYHKYLIGRGGANIRRVRDRTGARIIFPSADDQEQEHITIMGKEEAV
ILAQRELETLIKNLDDVIEDSMIVEPRHHRHFVCRRGQVLRELAEEYGGVAVSFPRTGTH
SDSITLKGPRECVDAAKKRIQEIVCDLESQVSMEVLIPQRYHRAIMGPKGCRIQQITREH
EVQIKFPDRDESAAQEPTSQENGDTDLTPRKCDIITVTGRAEKCELARAALLALVPVTID
VEVSYDLHRYIIGQKGSGIRKMMEDYEVNIWVPQPEQQSDIIKITGQVASVERAKHGLLD
RVKELQAEQEDRALRSYKVTLSVDPKYHPKIIGRKGAVISQIRKEYDVNVQFPDKGDEQQ
DVIVISGYERNANDAKSAIEQLVAALQEMVSEDVRLDRRVHARIIGARGKAIRKIMEEFK
VDIRFPQPGSEDPNKVTVTGLPENVDNTIDHLLNLEEEYMLSVTETETMAAYMKPPSKTM
GTGGNDEDNRALAKGFVVRDAPWNAQGNKAPDVSSAEEFPTFGSGITPKQTSAWGPKKC
Download sequence
Identical sequences E7FCA5
XP_021335983.1.45394 XP_683005.3.45394 ENSDARP00000109853 ENSDARP00000127252 ENSDARP00000109853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]