SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110154 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000110154
Domain Number - Region: 14-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000315
Family Ras-binding domain, RBD 0.029
Further Details:      
 
Domain Number - Region: 95-137
Classification Level Classification E-value
Superfamily PH domain-like 0.00299
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110154   Gene: ENSDARG00000091634   Transcript: ENSDART00000127249
Sequence length 164
Comment pep:known chromosome:Zv9:15:47051984:47057616:-1 gene:ENSDARG00000091634 transcript:ENSDART00000127249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWLTLIMFDRQIPATMTAAELTFEVLDRRKISVKEKDYWCCFEVNEKEEIERPLHYQE
KVLPIFHSLGTDSHLLVKKHFSMEAMLVYLASKVEVSKHGMMKFREERSLLGLGLSTGHF
NDRYFILTSTSLRLYKEVRVRVCVCVCVFIFPEGNLKLYITASL
Download sequence
Identical sequences ENSDARP00000110154 ENSDARP00000110154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]