SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110307 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110307
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.26e-20
Family Synaptotagmin-like (S variant) 0.0074
Further Details:      
 
Domain Number 2 Region: 117-250
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.12e-16
Family Synaptotagmin-like (S variant) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110307   Gene: ENSDARG00000086220   Transcript: ENSDART00000122853
Sequence length 261
Comment pep:known chromosome:Zv9:18:20945918:20949208:-1 gene:ENSDARG00000086220 transcript:ENSDART00000122853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVTVLDAQDLAVRDFSHSVDPFVWVRLMWAEREDKEKNSMRCLLHEWQTRIVKNSCCPV
FGDQFSCILAEDEVSRVTVRFEVRDFDKYSRHGVLGETRASLNTLKISYPLELRQDLQVP
RKDIVGEALLSLKYMPTSQRLEVGVLKIHTVCYHNKTERALYARTIVTCNQSRLRHQRTT
QKKRREVTVFNEVMTFVLPDQQIKECSIEVSVYEIQPSKKSSKNLIGHIQVKKNKTGENE
HWKQMMQSLRQPVANWHLIYI
Download sequence
Identical sequences ENSDARP00000110307 ENSDARP00000110307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]