SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110861 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110861
Domain Number 1 Region: 8-302
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.28e-52
Family WD40-repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110861   Gene: ENSDARG00000007755   Transcript: ENSDART00000130809
Sequence length 305
Comment pep:known chromosome:Zv9:25:6634147:6645426:-1 gene:ENSDARG00000007755 transcript:ENSDART00000130809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTQYSILFKQEHAHEDAIWTAAWGRSEKDGSETIVTGSLDDLVKVWKWSDEKLELQWTL
EGHQLGVVSVNISQNGAIAASSSLDAHIRLWDLETGKQIKSMDAGPVDAWTVAFSPDSKY
IATGSHLGKVNIFGVESGKKEHSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATG
KLLHTLEVLTLPVKSLSFHPSIILYLSIYLSIYLSIYLCLSVCLSIYLSIYCSFILSIYP
SKFKSEFCSNTSQTHLNKLDTSPRECNRIIYDTHNWVWSVKYNPTGSKIVSAGDDRAIHI
YDCPM
Download sequence
Identical sequences E7F786
ENSDARP00000110861 ENSDARP00000110861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]