SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111081 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111081
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-20
Family PLC-like (P variant) 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111081   Gene: ENSDARG00000090528   Transcript: ENSDART00000126056
Sequence length 90
Comment pep:known chromosome:Zv9:2:57034232:57068290:1 gene:ENSDARG00000090528 transcript:ENSDART00000126056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLCVGVKKAKYDGPQEKFNTYVTLKVQNVKSTTIAVRGSDPSWEQDFMFEINRLDLGL
TVEVWNKGLIWDTMVGYVWMPLQSIRQSNE
Download sequence
Identical sequences ENSDARP00000111081 ENSDARP00000111081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]