SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111140 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111140
Domain Number 1 Region: 56-301
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.75e-39
Family WD40-repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111140   Gene: ENSDARG00000091587   Transcript: ENSDART00000124940
Sequence length 398
Comment pep:known scaffold:Zv9:Zv9_NA747:7991:15266:-1 gene:ENSDARG00000091587 transcript:ENSDART00000124940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQMHKISPSSKFRHIQGSVLHRDTHITNLRGLHLTTPGECDGFCANGERVAVPLAIAGGQ
IAVFELSQPGKLPDTALPTIQNSVNVADFCWDPFDPHRLVVAGDDAKIRVWQIPKGGLQE
TLTEPECVLRGHTEKIYSVKFHPHAIGLLVSSSYDLTVRLWSLETGEQVKQLSGHQDQIF
GMAWSPDGKLLATVCKDGKVRLYDPRKSTSPIQEGPGPEGQRGARVVWVCGGKFLMVSGF
DSRSERQLYLFSAESLASGSLASAPADVSPSTLIPFYDPDTSVLILTGKGDTRVYIYEIV
PEAPYFMECSSFNSSEPHKGLCFLPKTECDVRDVEVARAVRLGKTTIEPVAFRVPRVKKE
FFQDDVFPDTAVWWESSLSAAEWLSGSDGQHRKISLRP
Download sequence
Identical sequences ENSDARP00000111140 ENSDARP00000111140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]