SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111217 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111217
Domain Number 1 Region: 207-293
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.34e-21
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 144-166
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000034
Family CCCH zinc finger 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111217   Gene: ENSDARG00000089396   Transcript: ENSDART00000124839
Sequence length 407
Comment pep:known chromosome:Zv9:21:31982302:31995854:-1 gene:ENSDARG00000089396 transcript:ENSDART00000124839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFPILCQTCLGENPYIRMTKEKFGKECKICARPFTVFRWCPGVRMRFKKTEVCQTCSKMK
NVCQTCLLDLEYGLPIQVRDTGLSVKDEVPRSDVNKEYYTQNMEREIANSDGTRPVGLLG
KAPSSSDMLLKLARTTPYYKRNRPHICSFWVKGECKRGEECPYRHEKPTDPDDPLADQNI
KDRYYGINDPVANKLLMRASTMPRLDVPDDKSITTLYIGGLGENVTDSELRNHFYQFGEI
RTITIVQRQQCAFIQFATRQAAETAAEKSFNKLIINGRRLNVKWGRSQAARGKGEKDGVT
ESGIRLEPVPGLPGALPPPPVSDEDASTNYFNLAPTPSPAVMNLGLPPPPGVTMPPPPGF
GPPMFHTMDPMAPPVPPPMALRPPGQVHYPSQDPQRMGAHASRHGGP
Download sequence
Identical sequences ENSDARP00000111217 ENSDARP00000111217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]