SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111311 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111311
Domain Number 1 Region: 11-89
Classification Level Classification E-value
Superfamily MIT domain 6.41e-22
Family MIT domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111311   Gene: ENSDARG00000044766   Transcript: ENSDART00000128352
Sequence length 246
Comment pep:known chromosome:Zv9:9:7316701:7328891:-1 gene:ENSDARG00000044766 transcript:ENSDART00000128352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQDLLPGVESSAVSVLKRAVQLDNCSRFQEALVCYQEGIQLLLDVLKAVKDEAKKMHYR
EKIKGYMERAEQIKEHTTKLKEEGKYHEQIKIADSSTGYSYESLFKPYITDGLTEVWVED
PYVRHVHQLYNFLRFCEMLLKCPSTVKTIHLLTSQDEDSSTQQSSALAEMKQSLLSKDIC
LDIQYSSTIHDREIRFNNGWIIKIGRGLDYFKKPKGRFSVGYCDYDLRECHETTVDIFHT
KHTKKT
Download sequence
Identical sequences B0S8J9
ENSDARP00000111311 7955.ENSDARP00000065802 ENSDARP00000111311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]