SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111340 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000111340
Domain Number - Region: 15-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0978
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111340   Gene: ENSDARG00000088298   Transcript: ENSDART00000124639
Sequence length 72
Comment pep:known chromosome:Zv9:17:50952666:50959073:-1 gene:ENSDARG00000088298 transcript:ENSDART00000124639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPEPCRIKQEDAEEQIDLIEEHVEIKEEKQYIKAEETPQLETCDINRNSRNRSICTLC
GKSFTQEVAICT
Download sequence
Identical sequences ENSDARP00000111340 ENSDARP00000111340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]