SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111489 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111489
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.02e-25
Family Canonical RBD 0.000036
Further Details:      
 
Domain Number 2 Region: 194-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.18e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 430-507
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.02e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 4 Region: 518-593
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 278-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000113
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111489   Gene: ENSDARG00000003421   Transcript: ENSDART00000128931
Sequence length 607
Comment pep:known chromosome:Zv9:9:12738982:12851801:-1 gene:ENSDARG00000003421 transcript:ENSDART00000128931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLYVGNLSPSVTVEDLKQLFGERKLPVTDQVLLKSGYAFVDFPDQNWAIKAIETLSGK
VELHGKVIEVDYSVPKKLRSRKIQIRNIPPHLQWEVLDSLLAQYGTVENVEQVNTDTETA
VVNVTYSTKEEAKVAVEKLIEQTFEDYSFKVSYIMDMDAAAALPGTRNRRGGRTSREQDS
QPGTSGSSLGSRQKQPDFPLRMLVPTQFVGAIIGKEGLTIKNITKQTQSKVDIHRKENAG
AAEKPITIHSTPEGCSTACHMIMDIMQKEAVDTKVTEDIPLKILAHNSLVGRLIGKEGRN
LKKIEEDTETKITISSLQDLTIYNPERTIIVKGSIEACCRAEVEIMKKLREAYENDVAAI
NQQSNLIPGLSLSALGIFSTGLSVLPPAAGPRGIPPVPPTGYNPFLGHSSQLGGLYGVPP
ASGISHQHTQAPEQEVVYLFIPTQAVGAIIGKKGQHIKQLARFAGASIKIAPAESPDVTQ
RMVIITGPPEAQFKAQGRIFGKLKEENFFTAKEEVKLETHIKVPSSAAGRVIGKGGKTVN
ELQNLTSAEVIVPRDQTPDENDEVFVKISGHFFASQTAQRKIREIIQQVKQQEQKHQQGA
PTTPRSK
Download sequence
Identical sequences A0A0B4J1B0
ENSDARP00000111489 NP_001108030.2.45394 ENSDARP00000111489 7955.ENSDARP00000093196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]