SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111542 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111542
Domain Number 1 Region: 552-599
Classification Level Classification E-value
Superfamily F-box domain 0.00000000017
Family F-box domain 0.0095
Further Details:      
 
Domain Number 2 Region: 38-98
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000582
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111542   Gene: ENSDARG00000091119   Transcript: ENSDART00000123073
Sequence length 692
Comment pep:known chromosome:Zv9:21:21846567:21851918:-1 gene:ENSDARG00000091119 transcript:ENSDART00000123073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYRKSGPRLHRHCETCYNRRCKASIEVSVSCMVINCRLLCGASFHLCKEDEHSLLCPN
EKVPCINAHYGCPFTMCRSRLAKHLEVCPASIVCCSMEWNRWPVQNPDAPLYPNLLKELH
EQESLDLSMALRDQKHLCARLKMRNCFPELMEEREEEPTPVEEEEDKEAAAGREAVPNGI
SINEHEGSVLLNGSSKSCEKAMNENMVLNGDIDKEKYNLFEKMFSMEKGGCKQAEASTTE
EKKGQKALSVTKPQDAFIEPKNEETNAPSVDVSKCGLAPWQDGVLERLGQEVKPREFNMY
IVHHGRMLISFGQMDACTPRERDFVYGSLEPIPVQTLRSFKVPTSYKQKRIQLREFKARV
MTEHKCVGTSDESTLSENKDGWEMDEMFATLLCYAESEIRGHKISEMVPTDGLYVDIATQ
TYNFATAPFKYNASLTEVTADMDLKLHLELDTETATLRHNKFTSAFSFMCGHFFRRDEFA
SHFKNVHLDIQSCMGGWFEQRCPLAYLGCTFSQKRLQPATQRAKVFYNRDLSIFTLTPEV
PACLQNNSPNLSEKAHVKYEDSLSNLPFEVLHHIASYLDSYTLSQLALVSRLFRDICATL
LQERGMVAFKWRKKSYSHGGARWKPTIVWEFSTLFSKVENWCIGDTPSMAEHLQNCPFYQ
TELKTEPFTLTNMSDIKGKGGNNLVSLFMGHK
Download sequence
Identical sequences I3ISU9
ENSDARP00000111542 ENSDARP00000125994 ENSDARP00000111542 XP_021329100.1.45394 XP_694708.3.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]