SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111791 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111791
Domain Number 1 Region: 20-133
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-21
Family PDZ domain 0.0000039
Further Details:      
 
Domain Number 2 Region: 197-245
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000171
Family Synaptotagmin-like (S variant) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111791   Gene: ENSDARG00000091823   Transcript: ENSDART00000124929
Sequence length 258
Comment pep:known scaffold:Zv9:Zv9_NA185:813:25938:-1 gene:ENSDARG00000091823 transcript:ENSDART00000124929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCECLYKNQRCIVNLTPQHPVTWQPSKDGERLIGRVVLNKRMKDGTVPRDTGALLGLKV
VGGKMTESGRLCAFITKVKRGSLADTVGHLRPGDQVLEWNGRVLQGATFKEVYNIILESK
PEPQVELVVSRPIGDVPRIPESTHGQLESSSSSFESQKMGPSISVTSPMSPGMLRDTSQY
LSGQLSSPCLSRRTTAFVPRVQVKLWYDKVGHQLIVTILGAKDLPPREDGRPRNPYVKIY
FLPDRRYILGEVQIYSGQ
Download sequence
Identical sequences ENSDARP00000111791 ENSDARP00000111791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]