SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111797 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111797
Domain Number 1 Region: 5-85
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000848
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111797   Gene: ENSDARG00000091234   Transcript: ENSDART00000127699
Sequence length 167
Comment pep:known chromosome:Zv9:7:21397519:21398924:-1 gene:ENSDARG00000091234 transcript:ENSDART00000127699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPESECGICYRAYNLGRRCPRQLSCKHTFCESCLVTIGRSAETHEPRIVCPLCRHSTEM
PEARIKDNLPVDEDIFERLVTAGSSQECEDDDDDDENAEEQHQDVPSPAGVPCLAREDVS
PPPRTRKGHLVKCLKKVWKKVVGDGNINCTISDADLRDLAVMSCYMM
Download sequence
Identical sequences E7EYM0
ENSDARP00000111797 XP_001922643.1.45394 ENSDARP00000111797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]