SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111921 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111921
Domain Number 1 Region: 11-296
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.52e-51
Family Cell cycle arrest protein BUB3 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111921   Gene: ENSDARG00000075883   Transcript: ENSDART00000130726
Sequence length 326
Comment pep:known chromosome:Zv9:12:50659371:50663709:1 gene:ENSDARG00000075883 transcript:ENSDART00000130726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGANEFKLAQGPEDSVSAVKFSPSSSQFLLVSSWDGSVRLYDASANSMRMKYQHLAPVL
DCAFSDPTHAWSGGLDSQLKTHDLNTDQDTIVGTHDAPIRCVEFCPEVNVLVTGSWDQSV
RLWDPRTPCNAGTFTQPEKVYTLSVAGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSLEVQKKKYAFKCHRLKENGIEQVYPVNAI
SFHSVHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPSSIASLSFSTDGSLLAIASSYMQE
LGDVSHPADAVFIRQVTDAETKPKST
Download sequence
Identical sequences Q6TNV6
ENSDARP00000111921 NP_991272.1.45394 7955.ENSDARP00000083664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]