SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112085 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112085
Domain Number 1 Region: 287-406
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000143
Family WD40-repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112085   Gene: ENSDARG00000086213   Transcript: ENSDART00000125776
Sequence length 423
Comment pep:known chromosome:Zv9:13:2298110:2351502:1 gene:ENSDARG00000086213 transcript:ENSDART00000125776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDSTTDLAPACNSTAMLNHNCTDDSISAASASDVQDRLSSLELRVQQQEDELTDMKAAL
ADVLRRLAQSEDSAAAAAKKQQNTKGQAPMREAYSMSCIANGSSSGRKSHRDTATVSVAR
KETLSSAAKSGSERKKDKPSMEEIKEKEEPPQANDKPPSAAPSPSSNPPSPHPQPPQPQR
QASVPAKRGSSAKRGMERSQSSTWDSADDSRNKLVKAASTSKLLSKVVKNAEKHRDPVIS
QAKMSTREKNSQEGEFIKMFMRGRPITMFIPSDVENYDDVRTELPPERLKLEWVYGYRGR
DCRANVYLLPTGEIVYFIASVVVLFNYEERTQRHYVGHTDCVKCLAVHPDKIRIATGQIA
GVDKDGRPLQPHVRIWDSVSLSTQQIIGLGTFERGVGSLAFSKAVSLTSAFSCSMHISSI
CIN
Download sequence
Identical sequences ENSDARP00000112085 ENSDARP00000112085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]