SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112116 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112116
Domain Number 1 Region: 57-127
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000297
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0064
Further Details:      
 
Domain Number 2 Region: 113-152
Classification Level Classification E-value
Superfamily SAP domain 0.0000000000305
Family SAP domain 0.001
Further Details:      
 
Domain Number 3 Region: 331-378
Classification Level Classification E-value
Superfamily RING/U-box 0.000000152
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 4 Region: 263-301
Classification Level Classification E-value
Superfamily SAP domain 0.0000058
Family SAP domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112116   Gene: ENSDARG00000054036   Transcript: ENSDART00000128698
Sequence length 384
Comment pep:known chromosome:Zv9:10:43130865:43181916:1 gene:ENSDARG00000054036 transcript:ENSDART00000128698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGASSMWASCCGLLNEVMGTGAVRTQQPGFGAGAGPFRFAPSAGYSTYPPSSTTSGSA
GLACKACGLAFSVFRRKHVCSDCKKSFCSLCSVLQENLRRCSTCHLLWGTAFQRPRLMRL
RVRDLRQYLTLRNINTDTCREKEDLVDLVLCHLGAELELGEDEEEEEEEEEEADTDSLPS
LPRSLSTPPASAARSSSQQSALSAAASQGEALSRSDSSGTNNQDHGDAASVSLLNLESHD
DMLEASPATQRRARASLSDLAHEDDIESLTVRQLKEILARNFVNFSGCCEKWELVERVHR
LYRENQLNRRSMENVSNSLAADGVQVAQLGGADENLCRICMDAVIDCVLLECGHMVTCTK
CGKRMSECPICRQYVVRAVHVFKS
Download sequence
Identical sequences F1RCH2
ENSDARP00000112116 ENSDARP00000112116 XP_005162486.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]