SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112282 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112282
Domain Number 1 Region: 166-479
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.33e-53
Family WD40-repeat 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112282   Gene: ENSDARG00000090311   Transcript: ENSDART00000121942
Sequence length 485
Comment pep:known chromosome:Zv9:5:6628888:6646946:-1 gene:ENSDARG00000090311 transcript:ENSDART00000121942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFICSENGDESSSDESAQSPGAEKCCLASDLMKLCGETKARNKARRRTTTQMELLYAHSG
DPDAPPEDFSSPLLPVVESPEGNKELTPAPYSGDREPVTKINAVQSEVNSSARSPTATER
KSLDRSPLTRRRMQERSQNHTDRSRTLDKPGVASPALAARSSRAARLQCVHVAEGHTKPL
LCLDSTDDLLFTGSKDRTCKVWNLVTGQEIMSLGDHPSSVVSVRYCSSLVFTVSTAYVKV
WDIRDSAKCIRTLTSSGQVSQGDACGGSAVAIPPGENQINQIALNPSGTFLYAASGNTVR
MWDLRRFVSTGKLTGHLGPVMCLTVDQMGKGQDVVITGSKDHTVKMFDVLEGAQGSISAA
HHFDPAHQDGLEAVATQGDSLFTAARDSCIKKWDLASKQMQEQVERAHCDPLSSLAVVPG
SSAVVTGCKGGLLKFWHTHTLRALGEVRGHESSVNDVCTNSSQLFTASDDRTVKIWQVKG
CLEDG
Download sequence
Identical sequences ENSDARP00000112282 ENSDARP00000112282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]