SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112313 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112313
Domain Number 1 Region: 52-173
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.93e-21
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Domain Number 2 Region: 223-273
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000179
Family CUE domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112313   Gene: ENSDARG00000086747   Transcript: ENSDART00000126917
Sequence length 276
Comment pep:known chromosome:Zv9:7:74847931:74858943:1 gene:ENSDARG00000086747 transcript:ENSDART00000126917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTISTQRGQVYIGELPQDFLRIMPTQQQQQVQLDAQAARQLQYGGSLGTAGRLSITVV
QAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHVTIPENLREGTVVDEWYSLSGRQGDDKEGMINLVMSFATIPAGMM
MQPQPVVLMPTVYQQGVGYVPIAGVPGMYNQGVVPMGMPAAPPVASQSAPCSEEDLKALQ
DMFPNLDKEVIRTVLEAQQGNKDAAINSLLQMAEEL
Download sequence
Identical sequences A0A0R4IZ33
7955.ENSDARP00000104220 7955.ENSDARP00000104363 ENSDARP00000112313 NP_996944.2.45394 ENSDARP00000112313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]